인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-EP001964HU
제품정보 : Transport
| Description | The recombinant human AQP4 protein is a fusion protein consists of the human AQP4 protein (253-323aa) partnered with the N-terminal 6xHis-SUMO tag. It was produced in the E.coli. This recombinant AQP4 protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 22 kDa protein band presented on the gel.Aquaporin 4 (AQP4) is one of the three types of aquaporins (AQPs) that have been described in astrocytes. AQP4 protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Its expression is mainly confined to astrocyte...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | AQP4 |
| Uniprot No. | P55087 |
| Research Area | Transport |
| Alternative Names | AQP 4; AQP-4; AQP4; AQP4_HUMAN; Aquaporin type 4; Aquaporin-4; Aquaporin4; HMIWC 2; HMIWC2; Mercurial insensitive water channel; Mercurial-insensitive water channel; MGC22454; MIWC; WCH 4; WCH4 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 253-323aa |
| Target Protein Sequence | CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 24.0kDa |
| Protein Length | Cytoplasmic Domain |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |