인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-EP013218MO
제품정보 : Cancer
| Description | The fusion tag N-terminal 10xHis tag and C-terminal Myc tag gene was added to the gene sequence corresponding to the E.coli of the mouse Lta protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transformed into the E.coli for expression. Following purification, the product is the recombinant mouse Lta protein carrying N-terminal 10xHis tag and C-terminal Myc tag. The SDS-PAGE assessed the purity of this recombinant Lta protein up to 85%. It had an apparent molecular weight of approximately 24 kDa. This recombinant Lta protein may have applicat...Read more |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | Lta |
| Uniprot No. | P09225 |
| Research Area | Cancer |
| Alternative Names | Lta; Tnfb; Tnfsf1; Lymphotoxin-alpha; LT-alpha; TNF-beta; Tumor necrosis factor ligand superfamily member 1 |
| Species | Mus musculus (Mouse) |
| Source | E.coli |
| Expression Region | 34-202aa |
| Target Protein Sequence | LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 23.6 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |