인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-MP010509HU
제품정보 : Immunology
| Description | The production of the recombinant human HLA class I histocompatibility antigen alpha chain G (HLA-G) is from the expression of the gene fragment corresponding to amino acids 25-338 of the human HLA-G protein in the mammalian cells. This full length of the mature recombinant HLA-G protein is fused with 6xHis-tag at the N-terminus. Its purity reaches up to 95% determined by SAS-PAGE. On the gel, this protein migrated to the molecular weight band of about 42 kDa. The LC-MS/MS analysis has validated its identity. It is available now. The target protein HLA-G is expressed on fetal-derived placental...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | HLA-G |
| Uniprot No. | P17693 |
| Alternative Names | B2 microglobulin; DADB-15K14.8; HLA 6.0; HLA class I histocompatibility antigen alpha chain G; HLA class I histocompatibility antigen; alpha chain G; HLA class I molecule; HLA G; HLA G antigen; HLA G histocompatibility antigen class I G; HLA G3; HLA-G; HLA-G histocompatibility antigen; class I; HLA60; HLAG; HLAG_HUMAN; Major histocompatibility complex class I G; MHC class I antigen; MHC class I antigen G; MHC G; T-cell A locus; TCA |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 25-338aa |
| Target Protein Sequence | GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 39.6kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |