인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-YP006125HU
제품정보 : Cancer
| Description | Recombinant Human Cancer/testis antigen 1 (CTAG1A) is a full-length protein expressed in the yeast. Structurally, it is 180 amino acid long protein of 20 kDa, containing a 6xHis-tag at the N-terminus. SDS-PAGE analysis measured its purity over 90%. In addition to producing specific antibodies, this recombinant CTAG1A protein can also be used in the studies of CTAG1A-expressing cancers. The expression of CTAG1A, also called NY-ESO-1, is restricted to immune-privileged organs such as testis and placenta (in spermatogonia/oogonia). CTAG1A1 is also highly and frequently expressed in malignancies a...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | CTAG1A |
| Uniprot No. | P78358 |
| Research Area | Cancer |
| Alternative Names | CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1 |
| Species | Homo sapiens (Human) |
| Source | Yeast |
| Expression Region | 1-180aa |
| Target Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 20.0kDa |
| Protein Length | Full Length |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |