인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-MP023924HU(M)b0
제품정보 : Biochemicals
| Description | The recombinant human transmembrane protease serine 2 (TMPRSS2) (R255Q) is expressed in the mammalian cells with N-terminally tagged 10xHis motif. Its expression region corresponds to amino acid residues 106-493 of the human TMPRSS2 protein. The purity of this recombinant protein is over 90% determined by the SDS-PAGE. Its endotoxin content is less than 1.0 EU/ug measured by the LAL method. Validation of its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) shows this protein is active. It is available now. The target protein TMPRSS2 is a cell surface protein mainly express...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | ①Recombinant Human TMPRSS2 His tag protein (CSB-MP023924HU(M)b0) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 19.16μM. ②Measured by Bromhexine Hydrochloride inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Bromhexine Hydrochloride inhibit EC50 is 81.79-154.2μM. ③Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-MP023924HU(M)b0), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.005877- 0.01293μM. |
| Target Names | TMPRSS2 |
| Uniprot No. | O15393 |
| Research Area | Biochemicals |
| Alternative Names | TMPRSS2; PRSS10; Transmembrane protease serine 2; Serine protease 10 |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 106-492aa(R255Q) |
| Target Protein Sequence | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG- |
| Mol. Weight | 46.4 kDa |
| Protein Length | Partial |
| Tag Info | N-terminal 10xHis-tagged |
| Form | Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |